PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR06G00600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 373aa    MW: 40393.7 Da    PI: 5.8673
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR06G00600.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.86.8e-201562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+llvd+++++G g+W++ ++  g++R++k+c++rw +yl
  LPERR06G00600.1 15 KGPWTPEEDKLLVDYIHKHGHGSWRRLPKLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding50.74.1e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T+ E+e+++++++ lG++ W++Ia ++  gRt++++k++w+++l
  LPERR06G00600.1  68 RGDFTKAEEEIIINLHATLGNK-WSSIAGKLK-GRTDNEIKNYWNTHL 113
                      899*******************.********9.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-25765IPR009057Homeodomain-like
PROSITE profilePS5129419.7151062IPR017930Myb domain
SuperFamilySSF466895.75E-3112109IPR009057Homeodomain-like
SMARTSM007173.8E-161464IPR001005SANT/Myb domain
PfamPF002491.7E-181562IPR001005SANT/Myb domain
CDDcd001673.77E-131762No hitNo description
PROSITE profilePS5129426.25663117IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-2666117IPR009057Homeodomain-like
SMARTSM007176.0E-1567115IPR001005SANT/Myb domain
PfamPF002492.5E-1468113IPR001005SANT/Myb domain
CDDcd001672.91E-1171113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MGRSPCCEQD ADVKKGPWTP EEDKLLVDYI HKHGHGSWRR LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGD FTKAEEEIII NLHATLGNKW SSIAGKLKGR TDNEIKNYWN THLRKKLMNQ  120
GIDPVTHRPR TDLLAGIPNL LAAAGAGGQL PLIDINAIKL HADAAKFQIL QGLIRVLTTA  180
AGAGAGAGGG IDHLMTTMLA SGLLGQQQQQ QQQLQLQQQL LQQLDGVDLS RFGQQFDGSC  240
NLPPLYDSSS SPAMSSLSPD SLLERYAGAG FQASDVMGSP EIVPPISMTT TTPVAAAPMP  300
AMVAADQDGG GSGGVSPCEQ TAAASSSTFE ELQNLNLDEL DINYERCWTE MLLEQLSNNA  360
SDMYPTKNNT TDM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121174108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006655703.11e-137PREDICTED: uncharacterized protein LOC102702197
TrEMBLA0A0D9WKZ10.0A0A0D9WKZ1_9ORYZ; Uncharacterized protein
STRINGOB06G10740.11e-137(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55293158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.22e-78myb domain protein 9